PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8352_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 214aa    MW: 24783.7 Da    PI: 8.0751
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8352_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.7e-191567456
                   -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                   + +f++eq++ Le +Fe ++ p  +++++LA++lgL+ rqV +WFqN+Ra+ k
  Neem_8352_f_2 15 KKRFSDEQIKSLEFMFEAESRPESRMKQRLADELGLQPRQVAIWFQNKRARSK 67
                   668************************************************99 PP

2HD-ZIP_I/II107.41.1e-3414103291
    HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +k+r+s+eq+k+LE +Fe+e++ e++ K++la eLglqprqva+WFqn+RAR ktkq+E++y++Lk+++++l+++ e L++++++L  ++
  Neem_8352_f_2  14 NKKRFSDEQIKSLEFMFEAESRPESRMKQRLADELGLQPRQVAIWFQNKRARSKTKQIEHEYNKLKAEFEKLASNYELLKRDNHSLLLQV 103
                    79***********************************************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.07969IPR001356Homeobox domain
SMARTSM003899.0E-161173IPR001356Homeobox domain
SuperFamilySSF466898.77E-171171IPR009057Homeodomain-like
PfamPF000461.5E-161467IPR001356Homeobox domain
CDDcd000861.71E-131570No hitNo description
Gene3DG3DSA:1.10.10.601.7E-171576IPR009057Homeodomain-like
PRINTSPR000315.7E-54049IPR000047Helix-turn-helix motif
PROSITE patternPS0002704467IPR017970Homeobox, conserved site
PRINTSPR000315.7E-54965IPR000047Helix-turn-helix motif
PfamPF021832.3E-1069104IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MNVEAIASIR MSNNKKRFSD EQIKSLEFMF EAESRPESRM KQRLADELGL QPRQVAIWFQ  60
NKRARSKTKQ IEHEYNKLKA EFEKLASNYE LLKRDNHSLL LQVRYSSSKL SADYISSVIR  120
EHYSKTICCR QLQKLKNILG KSHDGSSNGK SENEDTTESK QVPSKTCVPF ESTVEDIAVM  180
SLEEHTESSG NWGRFDSGFL DQSSSTSQWW ELWS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476286.15e-81PREDICTED: homeobox-leucine zipper protein ATHB-12-like isoform X1
TrEMBLA0A067GMV81e-70A0A067GMV8_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1805779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-34homeobox 7